SCOP 1.61: Domain d1hbhc_: 1hbh C:

Lineage for d1hbhc_ (1hbh C:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)

6. Protein Hemoglobin, alpha-chain [46486] (16 species)

7. Species Antarctic fish (Pagothenia bernacchii) [46495] (2 PDB entries)

8. Domain d1hbhc_: 1hbh C: [15405]
   Other proteins in same PDB: d1hbhb_, d1hbhd_

Details for d1hbhc_

PDB Entry: 1hbh, 2.2 Å

PDB Description: structure of deoxyhaemoglobin of the antarctic fish pagothenia bernacchii and structural basis of the root effect

SCOP Domain Sequences for d1hbhc_:

Sequence; same for both SEQRES and ATOM records:

>d1hbhc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Antarctic fish (Pagothenia bernacchii)}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

Timeline for d1hbhc_:

• d1hbhc_ first appeared (with stable ids) in SCOP 1.55
  
• d1hbhc_ appears in SCOP 1.59
  
• d1hbhc_ appears in SCOP 1.63
  
• d1hbhc_ appears in the current release, SCOPe 2.08