SCOP 1.71: Domain d1pbxa_: 1pbx A:

Lineage for d1pbxa_ (1pbx A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (19 species)

7. Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (4 PDB entries)

8. Domain d1pbxa_: 1pbx A: [15403]
   Other proteins in same PDB: d1pbxb_
   complexed with hem

Details for d1pbxa_

PDB Entry: 1pbx, 2.5 Å

PDB Description: haemoglobin of the antarctic fish pagothenia bernacchii: amino acid sequence, oxygen equilibria and crystal structure of its carbonmonoxy derivative

SCOP Domain Sequences for d1pbxa_:

Sequence; same for both SEQRES and ATOM records:

>d1pbxa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii)}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

Timeline for d1pbxa_:

• d1pbxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1pbxa_ appears in SCOP 1.69
  
• d1pbxa_ appears in SCOP 1.73
  
• d1pbxa_ appears in the current release, SCOPe 2.08