SCOP 1.55: Domain d1pbxa_: 1pbx A:

Lineage for d1pbxa_ (1pbx A:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (16 proteins)

6. Protein Hemoglobin, alpha-chain [46486] (13 species)

7. Species Antarctic fish (Pagothenia bernacchii) [46495] (2 PDB entries)

8. Domain d1pbxa_: 1pbx A: [15403]
   Other proteins in same PDB: d1pbxb_

Details for d1pbxa_

PDB Entry: 1pbx, 2.5 Å

PDB Description: haemoglobin of the antarctic fish pagothenia bernacchii: amino acid sequence, oxygen equilibria and crystal structure of its carbonmonoxy derivative

SCOP Domain Sequences for d1pbxa_:

Sequence; same for both SEQRES and ATOM records:

>d1pbxa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Antarctic fish (Pagothenia bernacchii)}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

Timeline for d1pbxa_:

• d1pbxa_ appears in SCOP 1.57
  
• d1pbxa_ appears in the current release, SCOPe 2.08