Lineage for d2z3rp_ (2z3r P:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462047Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 1462048Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 1462049Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins)
    Pfam PF00084
  6. 1462264Protein Interleukin-15 receptor subunit alpha [161139] (2 species)
  7. 1462265Species Human (Homo sapiens) [TaxId:9606] [161141] (4 PDB entries)
    Uniprot Q13261 31-108! Uniprot Q13261 31-96
  8. 1462275Domain d2z3rp_: 2z3r P: [154021]
    Other proteins in same PDB: d2z3ra_, d2z3rc_, d2z3re_, d2z3rg_, d2z3ri_, d2z3rk_, d2z3rm_, d2z3ro_
    automated match to d2z3qb1
    complexed with gol

Details for d2z3rp_

PDB Entry: 2z3r (more details), 2 Å

PDB Description: Crystal structure of the IL-15/IL-15Ra complex
PDB Compounds: (P:) Interleukin-15 receptor alpha chain

SCOPe Domain Sequences for d2z3rp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z3rp_ g.18.1.1 (P:) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]}
sitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwttp
slkcirdpalvh

SCOPe Domain Coordinates for d2z3rp_:

Click to download the PDB-style file with coordinates for d2z3rp_.
(The format of our PDB-style files is described here.)

Timeline for d2z3rp_: