Lineage for d2z3ro_ (2z3r O:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1486907Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1486908Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1486997Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 1487029Protein Interleukin-15 (IL-15) [158422] (2 species)
  7. 1487030Species Human (Homo sapiens) [TaxId:9606] [158423] (3 PDB entries)
    Uniprot P40933 49-162
  8. 1487040Domain d2z3ro_: 2z3r O: [154020]
    Other proteins in same PDB: d2z3rb_, d2z3rd_, d2z3rf_, d2z3rh_, d2z3rj_, d2z3rl_, d2z3rn_, d2z3rp_
    automated match to d2z3qa1
    complexed with gol

Details for d2z3ro_

PDB Entry: 2z3r (more details), 2 Å

PDB Description: Crystal structure of the IL-15/IL-15Ra complex
PDB Compounds: (O:) Interleukin-15

SCOPe Domain Sequences for d2z3ro_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z3ro_ a.26.1.2 (O:) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]}
amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
dasihdtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfint

SCOPe Domain Coordinates for d2z3ro_:

Click to download the PDB-style file with coordinates for d2z3ro_.
(The format of our PDB-style files is described here.)

Timeline for d2z3ro_: