Lineage for d1ouuc_ (1ouu C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1254022Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1254593Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [46494] (2 PDB entries)
  8. 1254596Domain d1ouuc_: 1ouu C: [15402]
    Other proteins in same PDB: d1ouub_, d1ouud_
    complexed with cmo, hem

Details for d1ouuc_

PDB Entry: 1ouu (more details), 2.5 Å

PDB Description: carbonmonoxy trout hemoglobin i
PDB Compounds: (C:) hemoglobin I

SCOPe Domain Sequences for d1ouuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ouuc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
sltakdksvvkafwgkisgkadvvgaealgrmltaypqtktyfshwadlspgsgpvkkhg
giimgaigkavglmddlvggmsalsdlhafklrvdpgnfkilshnilvtlaihfpsdftp
evhiavdkflaavsaaladkyr

SCOPe Domain Coordinates for d1ouuc_:

Click to download the PDB-style file with coordinates for d1ouuc_.
(The format of our PDB-style files is described here.)

Timeline for d1ouuc_: