Class a: All alpha proteins [46456] (179 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (18 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (16 species) |
Species Trout (Oncorhynchus mykiss) [TaxId:8022] [46494] (2 PDB entries) |
Domain d1ouuc_: 1ouu C: [15402] Other proteins in same PDB: d1ouub_, d1ouud_ complexed with ace, cmo, hem; mutant |
PDB Entry: 1ouu (more details), 2.5 Å
SCOP Domain Sequences for d1ouuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ouuc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Trout (Oncorhynchus mykiss)} sltakdksvvkafwgkisgkadvvgaealgrmltaypqtktyfshwadlspgsgpvkkhg giimgaigkavglmddlvggmsalsdlhafklrvdpgnfkilshnilvtlaihfpsdftp evhiavdkflaavsaaladkyr
Timeline for d1ouuc_: