Lineage for d2z3rm_ (2z3r M:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 912412Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 912413Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 912488Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 912516Protein Interleukin-15 (IL-15) [158422] (2 species)
  7. 912517Species Human (Homo sapiens) [TaxId:9606] [158423] (2 PDB entries)
    Uniprot P40933 49-162
  8. 912526Domain d2z3rm_: 2z3r M: [154018]
    Other proteins in same PDB: d2z3rb1, d2z3rd1, d2z3rf1, d2z3rh1, d2z3rj1, d2z3rl1, d2z3rn1, d2z3rp1
    automated match to d2z3qa1
    complexed with gol

Details for d2z3rm_

PDB Entry: 2z3r (more details), 2 Å

PDB Description: Crystal structure of the IL-15/IL-15Ra complex
PDB Compounds: (M:) Interleukin-15

SCOPe Domain Sequences for d2z3rm_:

Sequence, based on SEQRES records: (download)

>d2z3rm_ a.26.1.2 (M:) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]}
amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
dasihdtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfints

Sequence, based on observed residues (ATOM records): (download)

>d2z3rm_ a.26.1.2 (M:) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]}
amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
dasihdtvenliilannslssvtesgckeceeleeknikeflqsfvhivqmfints

SCOPe Domain Coordinates for d2z3rm_:

Click to download the PDB-style file with coordinates for d2z3rm_.
(The format of our PDB-style files is described here.)

Timeline for d2z3rm_: