Lineage for d2z3ri_ (2z3r I:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1730528Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1730529Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1730619Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 1730659Protein Interleukin-15 (IL-15) [158422] (2 species)
  7. 1730660Species Human (Homo sapiens) [TaxId:9606] [158423] (3 PDB entries)
    Uniprot P40933 49-162
  8. 1730667Domain d2z3ri_: 2z3r I: [154014]
    Other proteins in same PDB: d2z3rb_, d2z3rd_, d2z3rf_, d2z3rh_, d2z3rj_, d2z3rl_, d2z3rn_, d2z3rp_
    automated match to d2z3qa1
    complexed with gol

Details for d2z3ri_

PDB Entry: 2z3r (more details), 2 Å

PDB Description: Crystal structure of the IL-15/IL-15Ra complex
PDB Compounds: (I:) Interleukin-15

SCOPe Domain Sequences for d2z3ri_:

Sequence, based on SEQRES records: (download)

>d2z3ri_ a.26.1.2 (I:) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]}
amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
dasihdtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfints

Sequence, based on observed residues (ATOM records): (download)

>d2z3ri_ a.26.1.2 (I:) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]}
amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
dasihdtvenliilannslssvtesgckeceeleeknikeflqsfvhivqmfints

SCOPe Domain Coordinates for d2z3ri_:

Click to download the PDB-style file with coordinates for d2z3ri_.
(The format of our PDB-style files is described here.)

Timeline for d2z3ri_: