Lineage for d2z3rf_ (2z3r F:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1703717Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 1703718Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 1703719Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 1703937Protein Interleukin-15 receptor subunit alpha [161139] (2 species)
  7. 1703938Species Human (Homo sapiens) [TaxId:9606] [161141] (4 PDB entries)
    Uniprot Q13261 31-108! Uniprot Q13261 31-96
  8. 1703943Domain d2z3rf_: 2z3r F: [154011]
    Other proteins in same PDB: d2z3ra_, d2z3rc_, d2z3re_, d2z3rg_, d2z3ri_, d2z3rk_, d2z3rm_, d2z3ro_
    automated match to d2z3qb1
    complexed with gol

Details for d2z3rf_

PDB Entry: 2z3r (more details), 2 Å

PDB Description: Crystal structure of the IL-15/IL-15Ra complex
PDB Compounds: (F:) Interleukin-15 receptor alpha chain

SCOPe Domain Sequences for d2z3rf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z3rf_ g.18.1.1 (F:) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]}
sitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwttp
slkcirdpalvhq

SCOPe Domain Coordinates for d2z3rf_:

Click to download the PDB-style file with coordinates for d2z3rf_.
(The format of our PDB-style files is described here.)

Timeline for d2z3rf_: