Lineage for d1ouua_ (1ouu A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 530658Protein Hemoglobin, alpha-chain [46486] (19 species)
  7. 531056Species Trout (Oncorhynchus mykiss) [TaxId:8022] [46494] (2 PDB entries)
  8. 531058Domain d1ouua_: 1ouu A: [15401]
    Other proteins in same PDB: d1ouub_, d1ouud_

Details for d1ouua_

PDB Entry: 1ouu (more details), 2.5 Å

PDB Description: carbonmonoxy trout hemoglobin i

SCOP Domain Sequences for d1ouua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ouua_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Trout (Oncorhynchus mykiss)}
sltakdksvvkafwgkisgkadvvgaealgrmltaypqtktyfshwadlspgsgpvkkhg
giimgaigkavglmddlvggmsalsdlhafklrvdpgnfkilshnilvtlaihfpsdftp
evhiavdkflaavsaaladkyr

SCOP Domain Coordinates for d1ouua_:

Click to download the PDB-style file with coordinates for d1ouua_.
(The format of our PDB-style files is described here.)

Timeline for d1ouua_: