Lineage for d1ouua_ (1ouu A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44046Protein Hemoglobin, alpha-chain [46486] (14 species)
  7. 44238Species Trout (Oncorhynchus mykiss) [TaxId:8022] [46494] (2 PDB entries)
  8. 44240Domain d1ouua_: 1ouu A: [15401]
    Other proteins in same PDB: d1ouub_, d1ouud_

Details for d1ouua_

PDB Entry: 1ouu (more details), 2.5 Å

PDB Description: carbonmonoxy trout hemoglobin i

SCOP Domain Sequences for d1ouua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ouua_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Trout (Oncorhynchus mykiss)}
sltakdksvvkafwgkisgkadvvgaealgrmltaypqtktyfshwadlspgsgpvkkhg
giimgaigkavglmddlvggmsalsdlhafklrvdpgnfkilshnilvtlaihfpsdftp
evhiavdkflaavsaaladkyr

SCOP Domain Coordinates for d1ouua_:

Click to download the PDB-style file with coordinates for d1ouua_.
(The format of our PDB-style files is described here.)

Timeline for d1ouua_: