SCOP 1.75: Domain d2z3rb1: 2z3r B:1-73

Lineage for d2z3rb1 (2z3r B:1-73)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins)
   Pfam PF00084

6. Protein Interleukin-15 receptor subunit alpha [161139] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161141] (3 PDB entries)
   Uniprot Q13261 31-108! Uniprot Q13261 31-96

8. Domain d2z3rb1: 2z3r B:1-73 [154007]
   Other proteins in same PDB: d2z3ra1, d2z3rc1, d2z3re1, d2z3rg1, d2z3ri1, d2z3rk1, d2z3rm1, d2z3ro1
   automatically matched to 2Z3Q B:1-78
   complexed with gol

Details for d2z3rb1

PDB Entry: 2z3r, 2 Å

PDB Description: Crystal structure of the IL-15/IL-15Ra complex

PDB Compounds: (B:) Interleukin-15 receptor alpha chain

SCOP Domain Sequences for d2z3rb1:

Sequence; same for both SEQRES and ATOM records:

>d2z3rb1 g.18.1.1 (B:1-73) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]}
itcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwttps
lkcirdpalvhqr

Timeline for d2z3rb1:

• d2z3rb1 is new in SCOP 1.75
  
• d2z3rb1 appears in SCOPe 2.01
  
• d2z3rb1 appears in the current release, SCOPe 2.08, called d2z3rb2