SCOPe 2.06: Domain d2z3qc2: 2z3q C:1-112

Lineage for d2z3qc2 (2z3q C:1-112)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-15 (IL-15) [158422] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158423] (3 PDB entries)
   Uniprot P40933 49-162

8. Domain d2z3qc2: 2z3q C:1-112 [154004]
   Other proteins in same PDB: d2z3qa2, d2z3qb1, d2z3qb2, d2z3qc3, d2z3qd2, d2z3qd3
   automated match to d2z3qa1

Details for d2z3qc2

PDB Entry: 2z3q, 1.85 Å

PDB Description: Crystal structure of the IL-15/IL-15Ra complex

PDB Compounds: (C:) Interleukin-15

SCOPe Domain Sequences for d2z3qc2:

Sequence; same for both SEQRES and ATOM records:

>d2z3qc2 a.26.1.2 (C:1-112) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]}
nwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesgdasih
dtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfin

Timeline for d2z3qc2:

• d2z3qc2 first appeared in SCOP 1.75, called d2z3qc1
  
• d2z3qc2 was called d2z3qc_ in SCOPe 2.05
  
• d2z3qc2 appears in SCOPe 2.07
  
• d2z3qc2 appears in the current release, SCOPe 2.08