![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
![]() | Protein Interleukin-15 (IL-15) [158422] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158423] (3 PDB entries) Uniprot P40933 49-162 |
![]() | Domain d2z3qa1: 2z3q A:1-114 [154002] Other proteins in same PDB: d2z3qb1, d2z3qd_ |
PDB Entry: 2z3q (more details), 1.85 Å
SCOPe Domain Sequences for d2z3qa1:
Sequence, based on SEQRES records: (download)
>d2z3qa1 a.26.1.2 (A:1-114) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]} nwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesgdasih dtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfints
>d2z3qa1 a.26.1.2 (A:1-114) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]} nwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesgdasih dtvenliilannslstesgckeceeleeknikeflqsfvhivqmfints
Timeline for d2z3qa1: