Lineage for d1outa_ (1out A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1716076Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1716683Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [46494] (2 PDB entries)
  8. 1716684Domain d1outa_: 1out A: [15400]
    Other proteins in same PDB: d1outb_
    complexed with hem

Details for d1outa_

PDB Entry: 1out (more details), 2.3 Å

PDB Description: trout hemoglobin i
PDB Compounds: (A:) hemoglobin I

SCOPe Domain Sequences for d1outa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1outa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
sltakdksvvkafwgkisgkadvvgaealgrmltaypqtktyfshwadlspgsgpvkkhg
giimgaigkavglmddlvggmsalsdlhafklrvdpgnfkilshnilvtlaihfpsdftp
evhiavdkflaavsaaladkyr

SCOPe Domain Coordinates for d1outa_:

Click to download the PDB-style file with coordinates for d1outa_.
(The format of our PDB-style files is described here.)

Timeline for d1outa_: