Lineage for d1outa_ (1out A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 93450Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 93460Family a.1.1.2: Globins [46463] (18 proteins)
  6. 93559Protein Hemoglobin, alpha-chain [46486] (16 species)
  7. 93766Species Trout (Oncorhynchus mykiss) [TaxId:8022] [46494] (2 PDB entries)
  8. 93767Domain d1outa_: 1out A: [15400]
    Other proteins in same PDB: d1outb_

Details for d1outa_

PDB Entry: 1out (more details), 2.3 Å

PDB Description: trout hemoglobin i

SCOP Domain Sequences for d1outa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1outa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Trout (Oncorhynchus mykiss)}
sltakdksvvkafwgkisgkadvvgaealgrmltaypqtktyfshwadlspgsgpvkkhg
giimgaigkavglmddlvggmsalsdlhafklrvdpgnfkilshnilvtlaihfpsdftp
evhiavdkflaavsaaladkyr

SCOP Domain Coordinates for d1outa_:

Click to download the PDB-style file with coordinates for d1outa_.
(The format of our PDB-style files is described here.)

Timeline for d1outa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1outb_