Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (22 species) |
Species Bar-headed goose (Anser indicus) [TaxId:8846] [46493] (3 PDB entries) |
Domain d1hv4g_: 1hv4 G: [15399] Other proteins in same PDB: d1hv4b_, d1hv4d_, d1hv4f_, d1hv4h_ complexed with hem |
PDB Entry: 1hv4 (more details), 2.8 Å
SCOPe Domain Sequences for d1hv4g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hv4g_ a.1.1.2 (G:) Hemoglobin, alpha-chain {Bar-headed goose (Anser indicus) [TaxId: 8846]} vlsaadktnvkgvfskisghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk kvvaalveavnhiddiagalsklsdlhaqklrvdpvnfkflghcflvvvaihhpsaltae vhasldkflcavgtvltakyr
Timeline for d1hv4g_: