SCOPe 2.05: Domain d2z2mc2: 2z2m C:693-750

Lineage for d2z2mc2 (2z2m C:693-750)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
   alpha1-beta3; 2 layers: alpha/beta; order 132

4. Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family)
   duplication: consists of 2 subdomains of this fold

5. Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein)

6. Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries)

8. Domain d2z2mc2: 2z2m C:693-750 [153945]
   Other proteins in same PDB: d2z2mb_, d2z2me_
   automated match to d1qmea2
   complexed with cds, so4

Details for d2z2mc2

PDB Entry: 2z2m, 2.6 Å

PDB Description: cefditoren-acylated penicillin-binding protein 2x (pbp2x) from streptococcus pneumoniae

PDB Compounds: (C:) penicillin-binding protein 2x

SCOPe Domain Sequences for d2z2mc2:

Sequence; same for both SEQRES and ATOM records:

>d2z2mc2 d.11.1.1 (C:693-750) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
aeevpdmygwtketaetlakwlnielefqgsgstvqkqdvrantaikdikkitltlgd

Timeline for d2z2mc2:

• d2z2mc2 first appeared in SCOP 1.75
  
• d2z2mc2 appears in SCOPe 2.04
  
• d2z2mc2 appears in SCOPe 2.06
  
• d2z2mc2 appears in the current release, SCOPe 2.08