Lineage for d1a4fa_ (1a4f A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44046Protein Hemoglobin, alpha-chain [46486] (14 species)
  7. 44051Species Bar-headed goose (Anser indicus) [TaxId:8846] [46493] (3 PDB entries)
  8. 44052Domain d1a4fa_: 1a4f A: [15394]
    Other proteins in same PDB: d1a4fb_

Details for d1a4fa_

PDB Entry: 1a4f (more details), 2 Å

PDB Description: bar-headed goose hemoglobin (oxy form)

SCOP Domain Sequences for d1a4fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4fa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Bar-headed goose (Anser indicus)}
vlsaadktnvkgvfskisghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
kvvaalveavnhiddiagalsklsdlhaqklrvdpvnfkflghcflvvvaihhpsaltae
vhasldkflcavgtvltakyr

SCOP Domain Coordinates for d1a4fa_:

Click to download the PDB-style file with coordinates for d1a4fa_.
(The format of our PDB-style files is described here.)

Timeline for d1a4fa_: