Lineage for d1hbrc_ (1hbr C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2299707Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2299742Species Chicken (Gallus gallus) [TaxId:9031] [46492] (1 PDB entry)
  8. 2299744Domain d1hbrc_: 1hbr C: [15393]
    Other proteins in same PDB: d1hbrb_, d1hbrd_
    complexed with hem

Details for d1hbrc_

PDB Entry: 1hbr (more details), 2.3 Å

PDB Description: r-state form of chicken hemoglobin d
PDB Compounds: (C:) protein (hemoglobin d)

SCOPe Domain Sequences for d1hbrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbrc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Chicken (Gallus gallus) [TaxId: 9031]}
mltaedkkliqqawekaashqeefgaealtrmfttypqtktyfphfdlspgsdqvrghgk
kvlgalgnavknvdnlsqamaelsnlhaynlrvdpvnfkllsqciqvvlavhmgkdytpe
vhaafdkflsavsavlaekyr

SCOPe Domain Coordinates for d1hbrc_:

Click to download the PDB-style file with coordinates for d1hbrc_.
(The format of our PDB-style files is described here.)

Timeline for d1hbrc_: