SCOP 1.73: Domain d1hbrc_: 1hbr C:

Lineage for d1hbrc_ (1hbr C:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (19 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [46492] (1 PDB entry)

8. Domain d1hbrc_: 1hbr C: [15393]
   Other proteins in same PDB: d1hbrb_, d1hbrd_
   complexed with hem

Details for d1hbrc_

PDB Entry: 1hbr, 2.3 Å

PDB Description: r-state form of chicken hemoglobin d

PDB Compounds: (C:) protein (hemoglobin d)

SCOP Domain Sequences for d1hbrc_:

Sequence; same for both SEQRES and ATOM records:

>d1hbrc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Chicken (Gallus gallus) [TaxId: 9031]}
mltaedkkliqqawekaashqeefgaealtrmfttypqtktyfphfdlspgsdqvrghgk
kvlgalgnavknvdnlsqamaelsnlhaynlrvdpvnfkllsqciqvvlavhmgkdytpe
vhaafdkflsavsavlaekyr

Timeline for d1hbrc_:

• d1hbrc_ first appeared (with stable ids) in SCOP 1.55
  
• d1hbrc_ appears in SCOP 1.71
  
• d1hbrc_ appears in SCOP 1.75
  
• d1hbrc_ appears in the current release, SCOPe 2.08