Class a: All alpha proteins [46456] (258 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (19 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [46492] (1 PDB entry) |
Domain d1hbrc_: 1hbr C: [15393] Other proteins in same PDB: d1hbrb_, d1hbrd_ complexed with hem |
PDB Entry: 1hbr (more details), 2.3 Å
SCOP Domain Sequences for d1hbrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hbrc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Chicken (Gallus gallus) [TaxId: 9031]} mltaedkkliqqawekaashqeefgaealtrmfttypqtktyfphfdlspgsdqvrghgk kvlgalgnavknvdnlsqamaelsnlhaynlrvdpvnfkllsqciqvvlavhmgkdytpe vhaafdkflsavsavlaekyr
Timeline for d1hbrc_: