Lineage for d1hbrc_ (1hbr C:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 94Protein Hemoglobin, alpha-chain [46486] (13 species)
  7. 109Species Chicken (Gallus gallus) [TaxId:9031] [46492] (1 PDB entry)
  8. 111Domain d1hbrc_: 1hbr C: [15393]
    Other proteins in same PDB: d1hbrb_, d1hbrd_

Details for d1hbrc_

PDB Entry: 1hbr (more details), 2.3 Å

PDB Description: r-state form of chicken hemoglobin d

SCOP Domain Sequences for d1hbrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbrc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Chicken (Gallus gallus)}
mltaedkkliqqawekaashqeefgaealtrmfttypqtktyfphfdlspgsdqvrghgk
kvlgalgnavknvdnlsqamaelsnlhaynlrvdpvnfkllsqciqvvlavhmgkdytpe
vhaafdkflsavsavlaekyr

SCOP Domain Coordinates for d1hbrc_:

Click to download the PDB-style file with coordinates for d1hbrc_.
(The format of our PDB-style files is described here.)

Timeline for d1hbrc_: