Lineage for d2z0sa2 (2z0s A:148-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947085Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2947086Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2947087Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 2947088Protein Exosome complex RNA-binding protein 1, ECR1 [160229] (3 species)
  7. 2947089Species Aeropyrum pernix [TaxId:56636] [160231] (1 PDB entry)
    Uniprot Q9YC02 148-234
  8. 2947090Domain d2z0sa2: 2z0s A:148-234 [153917]
    Other proteins in same PDB: d2z0sa1
    protein/RNA complex

Details for d2z0sa2

PDB Entry: 2z0s (more details), 3.2 Å

PDB Description: Crystal structure of putative exosome complex RNA-binding protein
PDB Compounds: (A:) Probable exosome complex RNA-binding protein 1

SCOPe Domain Sequences for d2z0sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]}
rgkiveispakvprvigrkmsmlktleekteckifvarngrihlecpnedleaiavmaik
iideeaytsgltkriikfieeerrire

SCOPe Domain Coordinates for d2z0sa2:

Click to download the PDB-style file with coordinates for d2z0sa2.
(The format of our PDB-style files is described here.)

Timeline for d2z0sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z0sa1