Lineage for d1qpwc_ (1qpw C:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44046Protein Hemoglobin, alpha-chain [46486] (14 species)
  7. 44231Species Pig (Sus scrofa) [TaxId:9823] [46491] (2 PDB entries)
  8. 44233Domain d1qpwc_: 1qpw C: [15391]
    Other proteins in same PDB: d1qpwb_, d1qpwd_

Details for d1qpwc_

PDB Entry: 1qpw (more details), 1.8 Å

PDB Description: crystal structure determination of porcine hemoglobin at 1.8a resolution

SCOP Domain Sequences for d1qpwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpwc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Pig (Sus scrofa)}
vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
vhasldkflanvstvltskyr

SCOP Domain Coordinates for d1qpwc_:

Click to download the PDB-style file with coordinates for d1qpwc_.
(The format of our PDB-style files is described here.)

Timeline for d1qpwc_: