SCOP 1.65: Domain d1qpwa_: 1qpw A:

Lineage for d1qpwa_ (1qpw A:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (16 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [46491] (2 PDB entries)

8. Domain d1qpwa_: 1qpw A: [15390]
   Other proteins in same PDB: d1qpwb_, d1qpwd_

Details for d1qpwa_

PDB Entry: 1qpw, 1.8 Å

PDB Description: crystal structure determination of porcine hemoglobin at 1.8a resolution

SCOP Domain Sequences for d1qpwa_:

Sequence; same for both SEQRES and ATOM records:

>d1qpwa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Pig (Sus scrofa)}
vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
vhasldkflanvstvltskyr

Timeline for d1qpwa_:

• d1qpwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1qpwa_ appears in SCOP 1.63
  
• d1qpwa_ appears in SCOP 1.67
  
• d1qpwa_ appears in the current release, SCOPe 2.08