Lineage for d1qpwa_ (1qpw A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 93450Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 93460Family a.1.1.2: Globins [46463] (18 proteins)
  6. 93559Protein Hemoglobin, alpha-chain [46486] (16 species)
  7. 93759Species Pig (Sus scrofa) [TaxId:9823] [46491] (2 PDB entries)
  8. 93760Domain d1qpwa_: 1qpw A: [15390]
    Other proteins in same PDB: d1qpwb_, d1qpwd_

Details for d1qpwa_

PDB Entry: 1qpw (more details), 1.8 Å

PDB Description: crystal structure determination of porcine hemoglobin at 1.8a resolution

SCOP Domain Sequences for d1qpwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpwa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Pig (Sus scrofa)}
vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
vhasldkflanvstvltskyr

SCOP Domain Coordinates for d1qpwa_:

Click to download the PDB-style file with coordinates for d1qpwa_.
(The format of our PDB-style files is described here.)

Timeline for d1qpwa_: