SCOP 1.65: Domain d2pghc_: 2pgh C:

Lineage for d2pghc_ (2pgh C:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (16 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [46491] (2 PDB entries)

8. Domain d2pghc_: 2pgh C: [15389]
   Other proteins in same PDB: d2pghb_, d2pghd_
   complexed with hem

Details for d2pghc_

PDB Entry: 2pgh, 2.8 Å

PDB Description: structure determination of aquomet porcine hemoglobin at 2.8 angstrom resolution

SCOP Domain Sequences for d2pghc_:

Sequence; same for both SEQRES and ATOM records:

>d2pghc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Pig (Sus scrofa)}
vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
vhasldkflanvstvltskyr

Timeline for d2pghc_:

• d2pghc_ first appeared (with stable ids) in SCOP 1.55
  
• d2pghc_ appears in SCOP 1.63
  
• d2pghc_ appears in SCOP 1.67
  
• d2pghc_ appears in the current release, SCOPe 2.08