SCOPe 2.01: Domain d2pgha_: 2pgh A:

Lineage for d2pgha_ (2pgh A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (22 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [46491] (2 PDB entries)

8. Domain d2pgha_: 2pgh A: [15388]
   Other proteins in same PDB: d2pghb_, d2pghd_
   complexed with hem

Details for d2pgha_

PDB Entry: 2pgh, 2.8 Å

PDB Description: structure determination of aquomet porcine hemoglobin at 2.8 angstrom resolution

PDB Compounds: (A:) hemoglobin (aquo met) (alpha chain)

SCOPe Domain Sequences for d2pgha_:

Sequence; same for both SEQRES and ATOM records:

>d2pgha_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Pig (Sus scrofa) [TaxId: 9823]}
vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
vhasldkflanvstvltskyr

Timeline for d2pgha_:

• d2pgha_ first appeared (with stable ids) in SCOP 1.55
  
• d2pgha_ appears in SCOP 1.75
  
• d2pgha_ appears in SCOPe 2.02
  
• d2pgha_ appears in the current release, SCOPe 2.08