Lineage for d1hdac_ (1hda C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686276Species Cow (Bos taurus) [TaxId:9913] [46490] (12 PDB entries)
  8. 2686296Domain d1hdac_: 1hda C: [15387]
    Other proteins in same PDB: d1hdab_, d1hdad_
    complexed with hem

Details for d1hdac_

PDB Entry: 1hda (more details), 2.2 Å

PDB Description: a novel allosteric mechanism in haemoglobin. structure of bovine deoxyhaemoglobin, absence of specific chloride-binding sites and origin of the chloride-linked bohr effect in bovine and human haemoglobin
PDB Compounds: (C:) hemoglobin (deoxy) (alpha chain)

SCOPe Domain Sequences for d1hdac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdac_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

SCOPe Domain Coordinates for d1hdac_:

Click to download the PDB-style file with coordinates for d1hdac_.
(The format of our PDB-style files is described here.)

Timeline for d1hdac_: