Lineage for d1hdaa_ (1hda A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1716076Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1716111Species Cow (Bos taurus) [TaxId:9913] [46490] (11 PDB entries)
  8. 1716128Domain d1hdaa_: 1hda A: [15386]
    Other proteins in same PDB: d1hdab_, d1hdad_
    complexed with hem

Details for d1hdaa_

PDB Entry: 1hda (more details), 2.2 Å

PDB Description: a novel allosteric mechanism in haemoglobin. structure of bovine deoxyhaemoglobin, absence of specific chloride-binding sites and origin of the chloride-linked bohr effect in bovine and human haemoglobin
PDB Compounds: (A:) hemoglobin (deoxy) (alpha chain)

SCOPe Domain Sequences for d1hdaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdaa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

SCOPe Domain Coordinates for d1hdaa_:

Click to download the PDB-style file with coordinates for d1hdaa_.
(The format of our PDB-style files is described here.)

Timeline for d1hdaa_: