Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (24 species) |
Species Cow (Bos taurus) [TaxId:9913] [46490] (12 PDB entries) |
Domain d1g09c_: 1g09 C: [15385] Other proteins in same PDB: d1g09b_, d1g09d_ complexed with cmo, hem |
PDB Entry: 1g09 (more details), 2.04 Å
SCOPe Domain Sequences for d1g09c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g09c_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]} vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa vhasldkflanvstvltskyr
Timeline for d1g09c_: