Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins) automatically mapped to Pfam PF01014 |
Protein automated matches [254656] (4 species) not a true protein |
Species Arthrobacter globiformis [TaxId:1665] [255720] (5 PDB entries) |
Domain d2yzbe2: 2yzb E:142-296 [153847] automated match to d2yzca2 complexed with urc |
PDB Entry: 2yzb (more details), 1.9 Å
SCOPe Domain Sequences for d2yzbe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yzbe2 d.96.1.4 (E:142-296) automated matches {Arthrobacter globiformis [TaxId: 1665]} seqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarwryntvevdfda vyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnkhhflvdlqpfg qdnpnevfyaadrpyglieatiqregsradhpiws
Timeline for d2yzbe2: