Lineage for d1g0ac_ (1g0a C:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 631855Protein Hemoglobin, alpha-chain [46486] (19 species)
  7. 631884Species Cow (Bos taurus) [TaxId:9913] [46490] (5 PDB entries)
  8. 631890Domain d1g0ac_: 1g0a C: [15383]
    Other proteins in same PDB: d1g0ab_, d1g0ad_
    complexed with cmo, hem

Details for d1g0ac_

PDB Entry: 1g0a (more details), 2.04 Å

PDB Description: carbonmonoxy liganded bovine hemoglobin ph 8.5
PDB Compounds: (C:) hemoglobin alpha chain

SCOP Domain Sequences for d1g0ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0ac_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

SCOP Domain Coordinates for d1g0ac_:

Click to download the PDB-style file with coordinates for d1g0ac_.
(The format of our PDB-style files is described here.)

Timeline for d1g0ac_: