Class a: All alpha proteins [46456] (258 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (19 species) |
Species Cow (Bos taurus) [TaxId:9913] [46490] (5 PDB entries) |
Domain d1g0ac_: 1g0a C: [15383] Other proteins in same PDB: d1g0ab_, d1g0ad_ complexed with cmo, hem |
PDB Entry: 1g0a (more details), 2.04 Å
SCOP Domain Sequences for d1g0ac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g0ac_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]} vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa vhasldkflanvstvltskyr
Timeline for d1g0ac_: