SCOPe 2.06: Domain d1g08c_: 1g08 C:

Lineage for d1g08c_ (1g08 C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (24 species)

7. Species Cow (Bos taurus) [TaxId:9913] [46490] (11 PDB entries)

8. Domain d1g08c_: 1g08 C: [15381]
   Other proteins in same PDB: d1g08b_, d1g08d_
   complexed with cmo, hem

Details for d1g08c_

PDB Entry: 1g08, 1.9 Å

PDB Description: carbonmonoxy liganded bovine hemoglobin ph 5.0

PDB Compounds: (C:) hemoglobin alpha chain

SCOPe Domain Sequences for d1g08c_:

Sequence; same for both SEQRES and ATOM records:

>d1g08c_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

Timeline for d1g08c_:

• d1g08c_ first appeared (with stable ids) in SCOP 1.55
  
• d1g08c_ appears in SCOPe 2.05
  
• d1g08c_ appears in SCOPe 2.07
  
• d1g08c_ appears in the current release, SCOPe 2.08