Lineage for d1g08a_ (1g08 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1473405Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1473440Species Cow (Bos taurus) [TaxId:9913] [46490] (11 PDB entries)
  8. 1473445Domain d1g08a_: 1g08 A: [15380]
    Other proteins in same PDB: d1g08b_, d1g08d_
    complexed with cmo, hem

Details for d1g08a_

PDB Entry: 1g08 (more details), 1.9 Å

PDB Description: carbonmonoxy liganded bovine hemoglobin ph 5.0
PDB Compounds: (A:) hemoglobin alpha chain

SCOPe Domain Sequences for d1g08a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g08a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

SCOPe Domain Coordinates for d1g08a_:

Click to download the PDB-style file with coordinates for d1g08a_.
(The format of our PDB-style files is described here.)

Timeline for d1g08a_: