![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Dodecameric ferritin homolog [47250] (16 species) |
![]() | Species Mycobacterium smegmatis [TaxId:1772] [109784] (5 PDB entries) Uniprot Q8VP75 |
![]() | Domain d2yw6c_: 2yw6 C: [153796] automated match to d1veia_ mutant |
PDB Entry: 2yw6 (more details), 2.53 Å
SCOPe Domain Sequences for d2yw6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yw6c_ a.25.1.1 (C:) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]} dkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevae riatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledl dlvsqdlliahagelekfqwfvrahlesag
Timeline for d2yw6c_: