SCOPe 2.06: Domain d1hdsc_: 1hds C:

Lineage for d1hdsc_ (1hds C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (24 species)

7. Species Deer (Odocoileus virginianus) [TaxId:9874] [46489] (1 PDB entry)

8. Domain d1hdsc_: 1hds C: [15379]
   Other proteins in same PDB: d1hdsb_, d1hdsd_
   complexed with hem

Details for d1hdsc_

PDB Entry: 1hds, 1.98 Å

PDB Description: macromolecular structure refinement by restrained least-squares and interactive graphics as applied to sickling deer type iii hemoglobin

PDB Compounds: (C:) hemoglobin s (deoxy) (alpha chain)

SCOPe Domain Sequences for d1hdsc_:

Sequence; same for both SEQRES and ATOM records:

>d1hdsc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Deer (Odocoileus virginianus) [TaxId: 9874]}
vlsaanksnvkaawgkvggnapaygaqalqrmflsfpttktyfphfdlshgsaqqkahgq
kvanaltkaqghlndlpgtlsnlsnlhahklrvnpvnfkllshsllvtlashlptnftpa
vhanlnkflandstvltskyr

Timeline for d1hdsc_:

• d1hdsc_ first appeared (with stable ids) in SCOP 1.55
  
• d1hdsc_ appears in SCOPe 2.05
  
• d1hdsc_ appears in SCOPe 2.07
  
• d1hdsc_ appears in the current release, SCOPe 2.08