SCOP 1.61: Domain d1hdsc_: 1hds C:

Lineage for d1hdsc_ (1hds C:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)

6. Protein Hemoglobin, alpha-chain [46486] (16 species)

7. Species Deer (Odocoileus virginianus) [TaxId:9874] [46489] (1 PDB entry)

8. Domain d1hdsc_: 1hds C: [15379]
   Other proteins in same PDB: d1hdsb_, d1hdsd_

Details for d1hdsc_

PDB Entry: 1hds, 1.98 Å

PDB Description: macromolecular structure refinement by restrained least-squares and interactive graphics as applied to sickling deer type iii hemoglobin

SCOP Domain Sequences for d1hdsc_:

Sequence; same for both SEQRES and ATOM records:

>d1hdsc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Deer (Odocoileus virginianus)}
vlsaanksnvkaawgkvggnapaygaqalqrmflsfpttktyfphfdlshgsaqqkahgq
kvanaltkaqghlndlpgtlsnlsnlhahklrvnpvnfkllshsllvtlashlptnftpa
vhanlnkflandstvltskyr

Timeline for d1hdsc_:

• d1hdsc_ first appeared (with stable ids) in SCOP 1.55
  
• d1hdsc_ appears in SCOP 1.59
  
• d1hdsc_ appears in SCOP 1.63
  
• d1hdsc_ appears in the current release, SCOPe 2.08