Lineage for d2dhba_ (2dhb A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) 
Protein Hemoglobin, alpha-chain [46486] (13 species) 
Species Horse (Equus caballus) [TaxId:9796] [46488] (4 PDB entries) 
Domain d2dhba_: 2dhb A: [15377]
Other proteins in same PDB: d2dhbb_
Details for d2dhba_
PDB Entry: 2dhb (more details), 2.8 Å
PDB Description: three dimensional fourier synthesis of horse deoxyhaemoglobin at 2.8 angstroms resolution
SCOP Domain Sequences for d2dhba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dhba_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus)}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvadgltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr
SCOP Domain Coordinates for d2dhba_:
Click to download the PDB-style file with coordinates for d2dhba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2dhba_:
- d2dhba_ appears in SCOP 1.57
- d2dhba_ appears in the current release, SCOPe 2.08
View in 3D
