Lineage for d2mhba_ (2mhb A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1716076Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1716172Species Horse (Equus caballus) [TaxId:9796] [46488] (16 PDB entries)
  8. 1716182Domain d2mhba_: 2mhb A: [15376]
    Other proteins in same PDB: d2mhbb_
    complexed with hem

Details for d2mhba_

PDB Entry: 2mhb (more details), 2 Å

PDB Description: the structure of horse methaemoglobin at 2.0 angstroms resolution
PDB Compounds: (A:) hemoglobin (aquo met) (alpha chain)

SCOPe Domain Sequences for d2mhba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mhba_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOPe Domain Coordinates for d2mhba_:

Click to download the PDB-style file with coordinates for d2mhba_.
(The format of our PDB-style files is described here.)

Timeline for d2mhba_: