Lineage for d2mhba_ (2mhb A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436191Protein Hemoglobin, alpha-chain [46486] (18 species)
  7. 436242Species Horse (Equus caballus) [TaxId:9796] [46488] (5 PDB entries)
  8. 436246Domain d2mhba_: 2mhb A: [15376]
    Other proteins in same PDB: d2mhbb_

Details for d2mhba_

PDB Entry: 2mhb (more details), 2 Å

PDB Description: the structure of horse methaemoglobin at 2.0 angstroms resolution

SCOP Domain Sequences for d2mhba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mhba_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus)}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOP Domain Coordinates for d2mhba_:

Click to download the PDB-style file with coordinates for d2mhba_.
(The format of our PDB-style files is described here.)

Timeline for d2mhba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2mhbb_