Lineage for d1g0ba_ (1g0b A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1976766Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 1976866Species Horse (Equus caballus) [TaxId:9796] [46488] (17 PDB entries)
  8. 1976871Domain d1g0ba_: 1g0b A: [15375]
    Other proteins in same PDB: d1g0bb_
    complexed with cmo, hem

Details for d1g0ba_

PDB Entry: 1g0b (more details), 1.9 Å

PDB Description: carbonmonoxy liganded equine hemoglobin ph 8.5
PDB Compounds: (A:) hemoglobin alpha chain

SCOPe Domain Sequences for d1g0ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0ba_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOPe Domain Coordinates for d1g0ba_:

Click to download the PDB-style file with coordinates for d1g0ba_.
(The format of our PDB-style files is described here.)

Timeline for d1g0ba_: