SCOP 1.73: Domain d1ibea_: 1ibe A:

Lineage for d1ibea_ (1ibe A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (19 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46488] (9 PDB entries)

8. Domain d1ibea_: 1ibe A: [15374]
   Other proteins in same PDB: d1ibeb_
   complexed with hem

Details for d1ibea_

PDB Entry: 1ibe, 1.8 Å

PDB Description: deoxy-haemoglobin trapped in the high-affinity (r) state

PDB Compounds: (A:) hemoglobin (deoxy)

SCOP Domain Sequences for d1ibea_:

Sequence; same for both SEQRES and ATOM records:

>d1ibea_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghagefgaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

Timeline for d1ibea_:

• d1ibea_ first appeared (with stable ids) in SCOP 1.55
  
• d1ibea_ appears in SCOP 1.71
  
• d1ibea_ appears in SCOP 1.75
  
• d1ibea_ appears in the current release, SCOPe 2.08