Lineage for d1ibea_ (1ibe A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 94Protein Hemoglobin, alpha-chain [46486] (13 species)
  7. 126Species Horse (Equus caballus) [TaxId:9796] [46488] (4 PDB entries)
  8. 127Domain d1ibea_: 1ibe A: [15374]
    Other proteins in same PDB: d1ibeb_

Details for d1ibea_

PDB Entry: 1ibe (more details), 1.8 Å

PDB Description: deoxy-haemoglobin trapped in the high-affinity (r) state

SCOP Domain Sequences for d1ibea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibea_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus)}
vlsaadktnvkaawskvgghagefgaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOP Domain Coordinates for d1ibea_:

Click to download the PDB-style file with coordinates for d1ibea_.
(The format of our PDB-style files is described here.)

Timeline for d1ibea_: