Lineage for d2vyvb1 (2vyv B:0-146,B:311-329)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828863Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1828919Species Escherichia coli [TaxId:562] [51802] (9 PDB entries)
    Uniprot P06977
  8. 1828933Domain d2vyvb1: 2vyv B:0-146,B:311-329 [153717]
    Other proteins in same PDB: d2vyva2, d2vyvb2, d2vyvc2
    automated match to d1s7ca1
    complexed with 1gp, fmt, nad

Details for d2vyvb1

PDB Entry: 2vyv (more details), 2.38 Å

PDB Description: structure of e.coli gapdh rat sperm gapdh heterotetramer
PDB Compounds: (B:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2vyvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vyvb1 c.2.1.3 (B:0-146,B:311-329) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
pskdntpmfvkganfdkyagqdivsnaXdnetgysnkvldliahisk

SCOPe Domain Coordinates for d2vyvb1:

Click to download the PDB-style file with coordinates for d2vyvb1.
(The format of our PDB-style files is described here.)

Timeline for d2vyvb1: