Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (20 species) |
Species Escherichia coli [TaxId:562] [55350] (9 PDB entries) Uniprot P06977 |
Domain d2vync2: 2vyn C:147-310 [153712] Other proteins in same PDB: d2vyna1, d2vynb1, d2vync1 automated match to d1s7ca2 complexed with fmt, nad |
PDB Entry: 2vyn (more details), 2.2 Å
SCOPe Domain Sequences for d2vync2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vync2 d.81.1.1 (C:147-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} scttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipss tgaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegem kgvlgyteddvvstdfngevctsvfdakagialndnfvklvswy
Timeline for d2vync2:
View in 3D Domains from other chains: (mouse over for more information) d2vyna1, d2vyna2, d2vynb1, d2vynb2 |