Lineage for d2vvsa2 (2vvs A:127-436)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832135Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 2832193Protein automated matches [254553] (3 species)
    not a true protein
  7. 2832194Species Bacteroides thetaiotaomicron [TaxId:226186] [255268] (4 PDB entries)
  8. 2832199Domain d2vvsa2: 2vvs A:127-436 [153656]
    Other proteins in same PDB: d2vvsa1, d2vvsa3
    automated match to d2choa2
    complexed with oan

Details for d2vvsa2

PDB Entry: 2vvs (more details), 2.24 Å

PDB Description: btgh84 structure in complex with pugnac
PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2vvsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vvsa2 c.1.8.10 (A:127-436) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa
qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisg
egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq
imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem
sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns
dlgpnghgyr

SCOPe Domain Coordinates for d2vvsa2:

Click to download the PDB-style file with coordinates for d2vvsa2.
(The format of our PDB-style files is described here.)

Timeline for d2vvsa2: