| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies) 5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology |
Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) ![]() |
| Family a.246.1.0: automated matches [254242] (1 protein) not a true family |
| Protein automated matches [254554] (3 species) not a true protein |
| Species Bacteroides thetaiotaomicron [TaxId:226186] [255269] (4 PDB entries) |
| Domain d2vvsa1: 2vvs A:437-592 [153655] Other proteins in same PDB: d2vvsa2, d2vvsa3 automated match to d2choa1 complexed with oan |
PDB Entry: 2vvs (more details), 2.24 Å
SCOPe Domain Sequences for d2vvsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vvsa1 a.246.1.0 (A:437-592) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt
atrvikplidrtfatvvkffnqkfnahldattdymp
Timeline for d2vvsa1: