Lineage for d2vvpd1 (2vvp D:3-158)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 848873Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 848874Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (1 family) (S)
  5. 848875Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (2 proteins)
  6. 848876Protein Alternate ribose 5-phosphate isomerase B, RpiB [89625] (2 species)
  7. 848882Species Mycobacterium tuberculosis [TaxId:1773] [102273] (6 PDB entries)
    Uniprot Q79FD7
    Rv2465c
  8. 848886Domain d2vvpd1: 2vvp D:3-158 [153648]
    automatically matched to d1uslc_
    complexed with 5rp, r52

Details for d2vvpd1

PDB Entry: 2vvp (more details), 1.65 Å

PDB Description: crystal structure of mycobacterium tuberculosis ribose-5-phosphate isomerase b in complex with its substrates ribose 5-phosphate and ribulose 5-phosphate
PDB Compounds: (D:) ribose-5-phosphate isomerase b

SCOP Domain Sequences for d2vvpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vvpd1 c.121.1.1 (D:3-158) Alternate ribose 5-phosphate isomerase B, RpiB {Mycobacterium tuberculosis [TaxId: 1773]}
gmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafciaaatrtvadpg
slgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligiggrmhtvaeala
ivdafvttpwskaqrhqrridilaeyertheappvp

SCOP Domain Coordinates for d2vvpd1:

Click to download the PDB-style file with coordinates for d2vvpd1.
(The format of our PDB-style files is described here.)

Timeline for d2vvpd1: